PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 275aa    MW: 31402.2 Da    PI: 7.7539
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23357.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK759.3e-24168215552
      RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 +++++++k+F  pi++AAk L+v+lT+LKr+CR++ I RWPhRk+ksl
  KHN23357.1 168 LEFDEIKKHFGVPITEAAKRLNVGLTMLKRRCRELSITRWPHRKLKSL 215
                 899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.415155237IPR003035RWP-RK domain
PfamPF020421.1E-21168215IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MEVSPLEGFS ELDWWTPQLP YSSNHLCFNE FPDLENLDLD FSLPSLGEHL EEVDQKPSNI  60
VVPEGLRCNH EKVFGDALLA TEHVSATCVK KEQVLNNIDQ SPLPVLLASN STTRKKPCAL  120
EFEEASFAIQ NQNGSATASY LKKEEVQNII HQRPLPVSSS SKKRTCVLEF DEIKKHFGVP  180
ITEAAKRLNV GLTMLKRRCR ELSITRWPHR KLKSLQLLID NVKEMGLEDE VPRLERQKRL  240
LEKLPGLELS EEAKKLRQAC FKANYKKRRC MALQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1883702e-43AC188370.9 Glycine max cultivar PI 96983 clone gmp1-120k16, complete sequence.
GenBankAP0150352e-43AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006581653.10.0PREDICTED: protein RKD5-like
TrEMBLA0A0B2QUL90.0A0A0B2QUL9_GLYSO; Protein RKD4
STRINGGLYMA06G13540.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-35RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]